eF-site ID 3h0l-ABCDEFGHIJKLMNOPQRSTUVWX
PDB Code 3h0l
Chain A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence A:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
B:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
C:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
D:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
E:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
F:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
G:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
H:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
I:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
J:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
K:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
L:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
M:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
N:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
O:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
P:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Q:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
R:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
S:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
T:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
U:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
V:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
W:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
X:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain B
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

2) chain B
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

3) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

4) chain B
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

5) chain B
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

6) chain B
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

7) chain B
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

8) chain B
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

9) chain B
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

10) chain B
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

11) chain B
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

12) chain B
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

13) chain B
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

14) chain B
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

15) chain B
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

16) chain B
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

17) chain B
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

18) chain B
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

19) chain B
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

20) chain E
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

21) chain E
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

22) chain E
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

23) chain E
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

24) chain E
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

25) chain E
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

26) chain E
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

27) chain E
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

28) chain E
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

29) chain E
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

30) chain E
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

31) chain E
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

32) chain E
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

33) chain E
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

34) chain E
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

35) chain E
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

36) chain E
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

37) chain E
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

38) chain E
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

39) chain H
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

40) chain H
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

41) chain H
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

42) chain H
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

43) chain H
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

44) chain H
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

45) chain H
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

46) chain H
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

47) chain H
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

48) chain H
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

49) chain H
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

50) chain H
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

51) chain H
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

52) chain H
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

53) chain H
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

54) chain H
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

55) chain H
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

56) chain H
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

57) chain H
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

58) chain K
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

59) chain K
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

60) chain K
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

61) chain K
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

62) chain K
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

63) chain K
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

64) chain K
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

65) chain K
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

66) chain K
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

67) chain K
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

68) chain K
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

69) chain K
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP K 704
source : BC1

70) chain K
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG K 804
source : BC2

71) chain K
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG K 804
source : BC2

72) chain K
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG K 804
source : BC2

73) chain K
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN K 904
source : BC3

74) chain K
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN K 904
source : BC3

75) chain K
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN K 904
source : BC3

76) chain K
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN K 904
source : BC3

77) chain N
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

78) chain N
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

79) chain N
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

80) chain N
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

81) chain N
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

82) chain N
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

83) chain N
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

84) chain N
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

85) chain N
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

86) chain N
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

87) chain N
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

88) chain N
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

89) chain N
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

90) chain N
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

91) chain N
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

92) chain N
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

93) chain N
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

94) chain N
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

95) chain N
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

96) chain Q
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

97) chain Q
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

98) chain Q
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

99) chain Q
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

100) chain Q
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

101) chain Q
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

102) chain Q
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

103) chain Q
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

104) chain Q
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

105) chain Q
residue 198
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

106) chain Q
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

107) chain Q
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

108) chain Q
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

109) chain Q
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

110) chain Q
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

111) chain Q
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

112) chain Q
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

113) chain Q
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

114) chain Q
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

115) chain Q
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

116) chain T
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

117) chain T
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

118) chain T
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

119) chain T
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

120) chain T
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

121) chain T
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

122) chain T
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

123) chain T
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

124) chain T
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

125) chain T
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

126) chain T
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

127) chain T
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

128) chain T
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

129) chain T
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

130) chain T
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

131) chain T
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

132) chain T
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

133) chain T
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

134) chain T
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

135) chain W
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

136) chain W
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

137) chain W
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

138) chain W
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

139) chain W
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

140) chain W
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

141) chain W
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

142) chain W
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

143) chain W
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

144) chain W
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

145) chain W
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

146) chain W
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

147) chain W
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

148) chain W
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

149) chain W
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

150) chain W
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

151) chain W
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

152) chain W
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

153) chain W
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

154) chain A
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

155) chain A
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

156) chain A
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

157) chain A
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

158) chain A
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

159) chain A
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

160) chain A
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

161) chain A
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

162) chain A
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

163) chain A
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

164) chain A
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

165) chain D
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

166) chain D
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

167) chain D
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

168) chain D
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

169) chain D
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

170) chain D
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

171) chain D
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

172) chain D
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

173) chain D
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

174) chain D
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

175) chain D
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN D 902
source : CC8

176) chain G
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

177) chain G
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

178) chain G
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

179) chain G
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

180) chain G
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

181) chain G
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

182) chain G
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

183) chain G
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

184) chain G
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

185) chain G
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

186) chain G
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

187) chain J
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

188) chain J
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

189) chain J
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

190) chain J
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

191) chain J
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

192) chain J
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

193) chain J
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

194) chain J
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

195) chain J
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

196) chain J
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

197) chain J
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

198) chain J
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN J 904
source : DC1

199) chain M
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

200) chain M
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

201) chain M
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

202) chain M
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

203) chain M
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

204) chain M
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

205) chain M
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

206) chain M
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

207) chain M
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

208) chain M
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

209) chain M
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

210) chain P
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

211) chain P
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

212) chain P
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

213) chain P
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

214) chain P
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

215) chain P
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

216) chain P
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

217) chain P
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

218) chain P
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

219) chain P
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

220) chain P
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

221) chain P
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

222) chain P
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

223) chain S
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

224) chain S
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

225) chain S
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

226) chain S
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

227) chain S
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

228) chain S
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

229) chain S
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

230) chain S
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

231) chain S
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

232) chain S
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

233) chain S
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

234) chain S
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN S 907
source : DC4

235) chain V
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

236) chain V
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

237) chain V
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

238) chain V
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

239) chain V
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

240) chain V
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

241) chain V
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

242) chain V
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

243) chain V
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN V 908
source : DC5

244) chain A
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

245) chain A
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

246) chain A
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI2

247) chain D
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI3

248) chain D
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI3

249) chain D
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI4

250) chain G
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

251) chain G
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

252) chain G
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI6

253) chain J
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI7

254) chain J
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI7

255) chain J
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI8

256) chain M
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

257) chain M
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

258) chain M
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI10

259) chain P
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

260) chain P
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

261) chain P
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI12

262) chain S
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI13

263) chain S
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI13

264) chain S
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI14

265) chain V
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI15

266) chain V
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI15

267) chain V
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI16

268) chain B
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

269) chain E
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

270) chain H
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

271) chain K
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

272) chain N
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

273) chain Q
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

274) chain T
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

275) chain W
residue 144-158
type prosite
ligand
sequence LNRAGTPLMEIVTEP
description Glutamyl-tRNA(Gln) amidotransferase subunit B signature.[LMFYCVI]-[DN]-R-x(3)-[PGA]-L-[LIVMCA]-E-[LIVMT]-x-[STL]-x-[PA].
source prosite : PS01234

276) chain A
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

277) chain D
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

278) chain G
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

279) chain J
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

280) chain M
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

281) chain P
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

282) chain S
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

283) chain V
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

284) chain A
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

285) chain A
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

286) chain A
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

287) chain A
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

288) chain A
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

289) chain A
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

290) chain A
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

291) chain B
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

292) chain B
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

293) chain B
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

294) chain B
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

295) chain B
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

296) chain B
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

297) chain D
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

298) chain D
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

299) chain D
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

300) chain D
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

301) chain D
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

302) chain D
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

303) chain D
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_D_902

304) chain E
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

305) chain E
residue 122-123
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence RR
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

306) chain E
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

307) chain E
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

308) chain E
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

309) chain E
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

310) chain G
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

311) chain G
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

312) chain G
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

313) chain G
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

314) chain G
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

315) chain G
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

316) chain G
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

317) chain H
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

318) chain H
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

319) chain H
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

320) chain H
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

321) chain H
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

322) chain H
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

323) chain J
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

324) chain J
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

325) chain J
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

326) chain J
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

327) chain J
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

328) chain J
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

329) chain J
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_J_904

330) chain K
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

331) chain K
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

332) chain K
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

333) chain K
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

334) chain K
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

335) chain K
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_K_704

336) chain M
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

337) chain M
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

338) chain M
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

339) chain M
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

340) chain M
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

341) chain M
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

342) chain M
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

343) chain N
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

344) chain N
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

345) chain N
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

346) chain N
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

347) chain N
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

348) chain N
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

349) chain P
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

350) chain P
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

351) chain P
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

352) chain P
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

353) chain P
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

354) chain P
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

355) chain P
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

356) chain Q
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

357) chain Q
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

358) chain Q
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

359) chain Q
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

360) chain Q
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

361) chain Q
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

362) chain S
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

363) chain S
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

364) chain S
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

365) chain S
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

366) chain S
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

367) chain S
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

368) chain S
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_S_907

369) chain T
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

370) chain T
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

371) chain T
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

372) chain T
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

373) chain T
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

374) chain V
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

375) chain V
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

376) chain V
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

377) chain V
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

378) chain V
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

379) chain V
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

380) chain V
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_V_908

381) chain W
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

382) chain W
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

383) chain W
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

384) chain W
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

385) chain W
residue 208-211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FGTR
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708


Display surface

Download
Links