eF-site ID 3h0l-A
PDB Code 3h0l
Chain A

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence A:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain A
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

2) chain A
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

3) chain A
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

4) chain A
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

5) chain A
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

6) chain A
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

7) chain A
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

8) chain A
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

9) chain A
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

10) chain A
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

11) chain A
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN A 901
source : CC7

12) chain A
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

13) chain A
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

14) chain A
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI2

15) chain A
residue 145-176
type prosite
ligand
sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA
description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL].
source prosite : PS00571

16) chain A
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

17) chain A
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

18) chain A
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

19) chain A
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

20) chain A
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

21) chain A
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901

22) chain A
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_A_901


Display surface

Download
Links