eF-site ID 3gzj-D PDB Code 3gzj Chain D click to enlarge Title Crystal Structure of Polyneuridine Aldehyde Esterase Complexed with 16-epi-Vellosimine Classification HYDROLASE Compound Polyneuridine-aldehyde esterase Source Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (PNAE_RAUSE) Sequence D:  QKHFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAG INPRRLDEIHTFRDYSEPLMEVMASIPPDEKVVLLGHSFG GMSLGLAMETYPEKISVAVFMSAMMPDPNHSLTYPFEKYN EKCPADMMLDSQFSTYGNPENPGMSMILGPQFMALKMFQN CSVEDLELAKMLTRPGSLFFQDLAKAKKFSTERYGSVKRA YIFCNEDKSFPVEFQKWFVESVGADKVKEIKEADAMGMLS QPREVCKCLLDISD Description Functional site 1) chain D residue 19 type sequence G description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 2) chain D residue 87 type sequence S description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 3) chain D residue 88 type sequence F description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 4) chain D residue 113 type sequence M description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 5) chain D residue 124 type sequence P description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 6) chain D residue 125 type sequence F description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 7) chain D residue 128 type sequence Y description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 8) chain D residue 137 type sequence M description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 9) chain D residue 157 type sequence L description BINDING SITE FOR RESIDUE EVS D 1000 source : AC4 10) chain D residue 87 type ACT_SITE sequence S description ACT_SITE => ECO:0000269|PubMed:12071952 source Swiss-Prot : SWS_FT_FI1 11) chain D residue 216 type ACT_SITE sequence D description ACT_SITE => ECO:0000269|PubMed:12071952 source Swiss-Prot : SWS_FT_FI1 12) chain D residue 244 type ACT_SITE sequence A description ACT_SITE => ECO:0000269|PubMed:12071952 source Swiss-Prot : SWS_FT_FI1 13) chain D residue 87 type BINDING sequence S description covalent => ECO:0000269|PubMed:19496101, ECO:0007744|PDB:3GZJ source Swiss-Prot : SWS_FT_FI2

Display surface Download Links