eF-site ID 3gx8-A PDB Code 3gx8 Chain A click to enlarge Title Structural and biochemical characterization of yeast monothiol glutaredoxin Grx5 Classification ELECTRON TRANSPORT Compound Monothiol glutaredoxin-5, mitochondrial Source null (GLRX5_YEAST) Sequence A:  STEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLL GNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVN KEFIGGCDVITSMARSGELADLLEEAQALVP Description Functional site 1) chain A residue 60 type sequence C description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 2) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 3) chain A residue 64 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 4) chain A residue 78 type sequence A description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 5) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 6) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 7) chain A residue 60 type sequence C description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 8) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 9) chain A residue 62 type sequence F description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 10) chain A residue 131 type sequence D description BINDING SITE FOR RESIDUE SO4 A 2 source : AC2 11) chain A residue 60 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q86SX6 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 92 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:Q86SX6 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 104 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:Q86SX6 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 117 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q86SX6 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 52 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:Q86SX6 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links