eF-site ID 3gx0-A PDB Code 3gx0 Chain A click to enlarge Title Crystal Structure of GSH-dependent Disulfide bond Oxidoreductase Classification TRANSFERASE Compound GST-like protein yfcG Source Escherichia coli (strain K12) (YFCG_ECOLI) Sequence A:  MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFR PEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLA EKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNH AAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYS IADIACWPWVNAWTRQRIDLAMYPAVKNWHERIRSRPATG QALL Description Functional site 1) chain A residue 9 type sequence T description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 2) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 3) chain A residue 38 type sequence Q description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 4) chain A residue 50 type sequence N description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 5) chain A residue 51 type sequence K description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 6) chain A residue 52 type sequence I description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 7) chain A residue 71 type sequence E description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 8) chain A residue 72 type sequence S description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 9) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 10) chain A residue 110 type sequence P description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 11) chain A residue 113 type sequence G description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 12) chain A residue 132 type sequence R description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 13) chain A residue 169 type sequence W description BINDING SITE FOR RESIDUE GDS A 301 source : AC1 14) chain A residue 11 type BINDING sequence N description BINDING => ECO:0000269|PubMed:19537707 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 38 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:19537707 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 52 type BINDING sequence I description BINDING => ECO:0000269|PubMed:19537707 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 71 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19537707 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 132 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19537707 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 40 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P08263 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links