eF-site ID 3gqo-D PDB Code 3gqo Chain D click to enlarge Title Crystal structure of macro domain of Venezuelan Equine Encephalitis virus in complex with ADP-ribose Classification VIRAL PROTEIN Compound Non-structural protein 3 Source Venezuelan equine encephalitis virus (strain P676) (VEEV) (POLN_EEVVP) Sequence D:  KAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYK KFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEV EGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKD RLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARR Description Functional site 1) chain D residue 9 type sequence G description BINDING SITE FOR RESIDUE APR D 167 source : AC4 2) chain D residue 10 type sequence D description BINDING SITE FOR RESIDUE APR D 167 source : AC4 3) chain D residue 11 type sequence I description BINDING SITE FOR RESIDUE APR D 167 source : AC4 4) chain D residue 22 type sequence A description BINDING SITE FOR RESIDUE APR D 167 source : AC4 5) chain D residue 24 type sequence N description BINDING SITE FOR RESIDUE APR D 167 source : AC4 6) chain D residue 30 type sequence G description BINDING SITE FOR RESIDUE APR D 167 source : AC4 7) chain D residue 31 type sequence G description BINDING SITE FOR RESIDUE APR D 167 source : AC4 8) chain D residue 32 type sequence G description BINDING SITE FOR RESIDUE APR D 167 source : AC4 9) chain D residue 33 type sequence V description BINDING SITE FOR RESIDUE APR D 167 source : AC4 10) chain D residue 34 type sequence C description BINDING SITE FOR RESIDUE APR D 167 source : AC4 11) chain D residue 108 type sequence L description BINDING SITE FOR RESIDUE APR D 167 source : AC4 12) chain D residue 110 type sequence S description BINDING SITE FOR RESIDUE APR D 167 source : AC4 13) chain D residue 111 type sequence T description BINDING SITE FOR RESIDUE APR D 167 source : AC4 14) chain D residue 112 type sequence G description BINDING SITE FOR RESIDUE APR D 167 source : AC4 15) chain D residue 113 type sequence I description BINDING SITE FOR RESIDUE APR D 167 source : AC4 16) chain D residue 114 type sequence F description BINDING SITE FOR RESIDUE APR D 167 source : AC4 17) chain D residue 144 type sequence R description BINDING SITE FOR RESIDUE APR D 167 source : AC4 18) chain D residue 24 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:Q8JUX6 source Swiss-Prot : SWS_FT_FI2 19) chain D residue 32 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:Q8JUX6 source Swiss-Prot : SWS_FT_FI2 20) chain D residue 10 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 21) chain D residue 112 type BINDING sequence G description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 22) chain D residue 113 type BINDING sequence I description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 23) chain D residue 114 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 24) chain D residue 0 type SITE sequence K description Cleavage; by protease nsP2 => ECO:0000250|UniProtKB:P03317 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links