eF-site ID 3gqo-A PDB Code 3gqo Chain A click to enlarge Title Crystal structure of macro domain of Venezuelan Equine Encephalitis virus in complex with ADP-ribose Classification VIRAL PROTEIN Compound Non-structural protein 3 Source Venezuelan equine encephalitis virus (strain P676) (VEEV) (POLN_EEVVP) Sequence A:  KAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYK KFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEV EGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKD RLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARR E Description Functional site 1) chain A residue 9 type sequence G description BINDING SITE FOR RESIDUE APR A 167 source : AC1 2) chain A residue 10 type sequence D description BINDING SITE FOR RESIDUE APR A 167 source : AC1 3) chain A residue 11 type sequence I description BINDING SITE FOR RESIDUE APR A 167 source : AC1 4) chain A residue 22 type sequence A description BINDING SITE FOR RESIDUE APR A 167 source : AC1 5) chain A residue 23 type sequence A description BINDING SITE FOR RESIDUE APR A 167 source : AC1 6) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE APR A 167 source : AC1 7) chain A residue 30 type sequence G description BINDING SITE FOR RESIDUE APR A 167 source : AC1 8) chain A residue 31 type sequence G description BINDING SITE FOR RESIDUE APR A 167 source : AC1 9) chain A residue 32 type sequence G description BINDING SITE FOR RESIDUE APR A 167 source : AC1 10) chain A residue 33 type sequence V description BINDING SITE FOR RESIDUE APR A 167 source : AC1 11) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE APR A 167 source : AC1 12) chain A residue 108 type sequence L description BINDING SITE FOR RESIDUE APR A 167 source : AC1 13) chain A residue 110 type sequence S description BINDING SITE FOR RESIDUE APR A 167 source : AC1 14) chain A residue 111 type sequence T description BINDING SITE FOR RESIDUE APR A 167 source : AC1 15) chain A residue 112 type sequence G description BINDING SITE FOR RESIDUE APR A 167 source : AC1 16) chain A residue 113 type sequence I description BINDING SITE FOR RESIDUE APR A 167 source : AC1 17) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE APR A 167 source : AC1 18) chain A residue 144 type sequence R description BINDING SITE FOR RESIDUE APR A 167 source : AC1 19) chain A residue 148 type sequence W description BINDING SITE FOR RESIDUE APR A 167 source : AC1 20) chain A residue 24 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:Q8JUX6 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 32 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:Q8JUX6 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 10 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 112 type BINDING sequence G description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 113 type BINDING sequence I description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 114 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 0 type SITE sequence K description Cleavage; by protease nsP2 => ECO:0000250|UniProtKB:P03317 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links