eF-site ID 3gpo-D PDB Code 3gpo Chain D click to enlarge Title Crystal structure of macro domain of Chikungunya virus in complex with ADP-ribose Classification VIRAL PROTEIN Compound Non-structural protein 3 Source Chikungunya virus (strain S27-African prototype) (CHIKV) (POLN_CHIKS) Sequence D:  PSYRVKRXDIAKNDEECVVNAANPRGLPGDGVCKAVYKKW PESFKNSATPVGTAKTVXCGTYPVIHAVGPNFSNYSESEG DRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRL TQSLNHLFTAXDSTDADVVIYCRDKEWEKKISEAIQXR Description Functional site 1) chain D residue 10 type sequence D description BINDING SITE FOR RESIDUE APR D 161 source : AC4 2) chain D residue 11 type sequence I description BINDING SITE FOR RESIDUE APR D 161 source : AC4 3) chain D residue 22 type sequence A description BINDING SITE FOR RESIDUE APR D 161 source : AC4 4) chain D residue 24 type sequence N description BINDING SITE FOR RESIDUE APR D 161 source : AC4 5) chain D residue 30 type sequence G description BINDING SITE FOR RESIDUE APR D 161 source : AC4 6) chain D residue 31 type sequence D description BINDING SITE FOR RESIDUE APR D 161 source : AC4 7) chain D residue 32 type sequence G description BINDING SITE FOR RESIDUE APR D 161 source : AC4 8) chain D residue 33 type sequence V description BINDING SITE FOR RESIDUE APR D 161 source : AC4 9) chain D residue 34 type sequence C description BINDING SITE FOR RESIDUE APR D 161 source : AC4 10) chain D residue 108 type sequence L description BINDING SITE FOR RESIDUE APR D 161 source : AC4 11) chain D residue 110 type sequence S description BINDING SITE FOR RESIDUE APR D 161 source : AC4 12) chain D residue 111 type sequence T description BINDING SITE FOR RESIDUE APR D 161 source : AC4 13) chain D residue 112 type sequence G description BINDING SITE FOR RESIDUE APR D 161 source : AC4 14) chain D residue 113 type sequence V description BINDING SITE FOR RESIDUE APR D 161 source : AC4 15) chain D residue 114 type sequence Y description BINDING SITE FOR RESIDUE APR D 161 source : AC4 16) chain D residue 148 type sequence W description BINDING SITE FOR RESIDUE APR D 161 source : AC4 17) chain D residue 10 type BINDING sequence D description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 18) chain D residue 24 type BINDING sequence N description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 19) chain D residue 32 type BINDING sequence G description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 20) chain D residue 112 type BINDING sequence G description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 21) chain D residue 113 type BINDING sequence V description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1 22) chain D residue 114 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:19386706 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links