eF-site ID 3gp9-A PDB Code 3gp9 Chain A click to enlarge Title Crystal structure of the Mimivirus NDK complexed with GDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source null (NDK_MIMIV) Sequence A:  AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFW SKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEG TDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSED SAVDEISIWFPET Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 3) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 4) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 5) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 6) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 7) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 8) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE GDP A 138 source : AC1 9) chain A residue 91 type sequence N description BINDING SITE FOR RESIDUE PO4 A 139 source : AC2 10) chain A residue 92 type sequence I description BINDING SITE FOR RESIDUE PO4 A 139 source : AC2 11) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE PO4 A 139 source : AC2 12) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE PO4 A 139 source : AC2 13) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE MG A 140 source : AC3 14) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE MG A 140 source : AC3 15) chain A residue 113 type sequence A description BINDING SITE FOR RESIDUE MG A 140 source : AC3 16) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 17) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links