eF-site ID 3go5-A PDB Code 3go5 Chain A click to enlarge Title Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 A resolution Classification GENE REGULATION Compound Multidomain protein with S1 RNA-binding domains Source (Q97R81_STRPN) Sequence A:  GXNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQH TVGDTVKGFAYTDXKQKLRLTTLEVTATQDQFGWGRVTEV RKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYI RLEVDKKDRIWGLLAYQEDFQRLARPAYNNXQNQNWPAIV YRLKLSGTFVYLPENNXLGFIHPSERYAEPRLGQVLDARV IGFREVDRTLNLSLKPRSFEXLENDAQXILTYLESNGGFX TLNDKSSPDDIKATFGISKGQFKKALGGLXKAGKIKQDQF GTELI Description Functional site 1) chain A residue 24 type sequence Q description BINDING SITE FOR RESIDUE CL A 285 source : AC1 2) chain A residue 204 type sequence E description BINDING SITE FOR RESIDUE CL A 285 source : AC1 3) chain A residue 205 type sequence V description BINDING SITE FOR RESIDUE CL A 285 source : AC1 4) chain A residue 162 type sequence L description BINDING SITE FOR RESIDUE EDO A 286 source : AC2 5) chain A residue 163 type sequence K description BINDING SITE FOR RESIDUE EDO A 286 source : AC2 6) chain A residue 164 type sequence L description BINDING SITE FOR RESIDUE EDO A 286 source : AC2 7) chain A residue 188 type sequence E description BINDING SITE FOR RESIDUE EDO A 286 source : AC2 8) chain A residue 251 type sequence K description BINDING SITE FOR RESIDUE EDO A 286 source : AC2 9) chain A residue 134 type sequence A description BINDING SITE FOR RESIDUE EDO A 287 source : AC3 10) chain A residue 135 type sequence Y description BINDING SITE FOR RESIDUE EDO A 287 source : AC3 11) chain A residue 160 type sequence Y description BINDING SITE FOR RESIDUE EDO A 287 source : AC3 12) chain A residue 161 type sequence R description BINDING SITE FOR RESIDUE EDO A 287 source : AC3 13) chain A residue 73 type sequence W description BINDING SITE FOR RESIDUE EDO A 288 source : AC4 14) chain A residue 116 type sequence Q description BINDING SITE FOR RESIDUE EDO A 288 source : AC4 15) chain A residue 278 type sequence Q description BINDING SITE FOR RESIDUE EDO A 288 source : AC4 16) chain A residue 279 type sequence F description BINDING SITE FOR RESIDUE EDO A 288 source : AC4 17) chain A residue 186 type sequence Y description BINDING SITE FOR RESIDUE EDO A 289 source : AC5 18) chain A residue 187 type sequence A description BINDING SITE FOR RESIDUE EDO A 289 source : AC5 19) chain A residue 193 type sequence Q description BINDING SITE FOR RESIDUE EDO A 289 source : AC5 20) chain A residue 243 type sequence D description BINDING SITE FOR RESIDUE EDO A 290 source : AC6 21) chain A residue 244 type sequence K description BINDING SITE FOR RESIDUE EDO A 290 source : AC6 22) chain A residue 277 type sequence D description BINDING SITE FOR RESIDUE EDO A 290 source : AC6 23) chain A residue 8 type sequence F description BINDING SITE FOR RESIDUE EDO A 291 source : AC7 24) chain A residue 46 type sequence K description BINDING SITE FOR RESIDUE EDO A 291 source : AC7 25) chain A residue 172 type sequence P description BINDING SITE FOR RESIDUE EDO A 292 source : AC8 26) chain A residue 173 type sequence E description BINDING SITE FOR RESIDUE EDO A 292 source : AC8 27) chain A residue 277 type sequence D description BINDING SITE FOR RESIDUE EDO A 292 source : AC8 28) chain A residue 279 type sequence F description BINDING SITE FOR RESIDUE EDO A 292 source : AC8 29) chain A residue 100 type sequence L description BINDING SITE FOR RESIDUE EDO A 293 source : AC9 30) chain A residue 101 type sequence D description BINDING SITE FOR RESIDUE EDO A 293 source : AC9 31) chain A residue 253 type sequence T description BINDING SITE FOR RESIDUE EDO A 293 source : AC9 32) chain A residue 1 type sequence X description BINDING SITE FOR RESIDUE EDO A 294 source : BC1 33) chain A residue 2 type sequence N description BINDING SITE FOR RESIDUE EDO A 294 source : BC1 34) chain A residue 3 type sequence T description BINDING SITE FOR RESIDUE EDO A 294 source : BC1 35) chain A residue 4 type sequence N description BINDING SITE FOR RESIDUE EDO A 294 source : BC1 36) chain A residue 26 type sequence D description BINDING SITE FOR RESIDUE EDO A 294 source : BC1

Display surface Download Links