eF-site ID 3giz-HL
PDB Code 3giz
Chain H, L

click to enlarge
Title Crystal structure of the Fab fragment of anti-CD20 antibody Ofatumumab
Classification IMMUNE SYSTEM
Compound Fab fragment of anti-CD20 antibody Ofatumumab, light chain
Source (3GIZ)
Sequence H:  EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQA
PGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLY
LQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTV
SSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEP
L:  EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKP
GQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNR
Description (1)  Fab fragment of anti-CD20 antibody Ofatumumab, light chain, Fab fragment of anti-CD20 antibody Ofatumumab, heavy chain


Functional site

1) chain L
residue 79
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 212
source : AC1

2) chain L
residue 79
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 212
source : AC1

3) chain L
residue 81
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 212
source : AC1

4) chain L
residue 81
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 212
source : AC1

5) chain H
residue 1
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

6) chain H
residue 173
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

7) chain L
residue 137
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

8) chain L
residue 138
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

9) chain L
residue 1
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 214
source : AC3

10) chain L
residue 185
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN L 214
source : AC3

11) chain L
residue 189
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN L 214
source : AC3

12) chain H
residue 203-209
type prosite
ligand
sequence YICNVNH
description Immunoglobulins and major histocompatibility complex proteins signature. [FY]-{L}-C-{PGAD}-[VA]-{LC}-H
source prosite : PS00290


Display surface

Download
Links