eF-site ID 3giz-H
PDB Code 3giz
Chain H

click to enlarge
Title Crystal structure of the Fab fragment of anti-CD20 antibody Ofatumumab
Classification IMMUNE SYSTEM
Compound Fab fragment of anti-CD20 antibody Ofatumumab, light chain
Source (3GIZ)
Sequence H:  EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQA
PGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLY
LQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTV
SSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEP
Description (1)  Fab fragment of anti-CD20 antibody Ofatumumab, light chain, Fab fragment of anti-CD20 antibody Ofatumumab, heavy chain


Functional site

1) chain H
residue 1
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

2) chain H
residue 173
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN L 213
source : AC2

3) chain H
residue 203-209
type prosite
ligand
sequence YICNVNH
description Immunoglobulins and major histocompatibility complex proteins signature. [FY]-{L}-C-{PGAD}-[VA]-{LC}-H
source prosite : PS00290


Display surface

Download
Links