eF-site ID 3gad-E PDB Code 3gad Chain E click to enlarge Title Structure of apomif Classification CYTOKINE Compound Macrophage migration inhibitory factor-like protein Source Plasmodium yoelii yoelii (Q1HEA2_PLAYO) Sequence E:  PCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMS NYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSSLADKI TKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFGLE Description Functional site 1) chain E residue 94 type sequence R description BINDING SITE FOR RESIDUE SO4 B 1 source : AC2 2) chain E residue 16 type sequence K description BINDING SITE FOR RESIDUE SO4 B 119 source : AC3 3) chain E residue 19 type sequence N description BINDING SITE FOR RESIDUE SO4 B 119 source : AC3 4) chain E residue 45 type sequence Y description BINDING SITE FOR RESIDUE ACY C 120 source : AC6 5) chain E residue 2 type sequence P description BINDING SITE FOR RESIDUE ACY E 1 source : AC8 6) chain E residue 3 type sequence C description BINDING SITE FOR RESIDUE ACY E 1 source : AC8 7) chain E residue 64 type sequence T description BINDING SITE FOR RESIDUE ACY E 1 source : AC8 8) chain E residue 66 type sequence I description BINDING SITE FOR RESIDUE ACY E 1 source : AC8 9) chain E residue 108 type sequence F description BINDING SITE FOR RESIDUE ACY E 1 source : AC8

Display surface Download Links