eF-site ID 3g7p-A PDB Code 3g7p Chain A click to enlarge Title Crystal structure of a nifx-associated protein of unknown function (afe_1514) from acidithiobacillus ferrooxidans atcc at 2.00 A resolution Classification UNKNOWN FUNCTION Compound Nitrogen fixation protein Source (B5ER68_ACIF5) Sequence A:  LPEESLFFRELVKQWRAQDSYGTWEKKSDXELLAPYVLDK EQRRAIPIIGDPDPEILWRVELFYNAVGLATERASGVXVS PXXKXSHEGFGRXVLIAGRLIVVNKQLRDVHRFGFPSXEK LAEEGDKLVAGALEXIEKFPEVARF Description Functional site 1) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 2) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 3) chain A residue 54 type sequence R description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 4) chain A residue 126 type sequence P description BINDING SITE FOR RESIDUE SO4 A 156 source : AC1 5) chain A residue 49 type sequence D description BINDING SITE FOR RESIDUE SO4 A 157 source : AC2 6) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE SO4 A 157 source : AC2 7) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE SO4 A 157 source : AC2 8) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE SO4 A 158 source : AC3 9) chain A residue 114 type sequence N description BINDING SITE FOR RESIDUE SO4 A 158 source : AC3 10) chain A residue 123 type sequence F description BINDING SITE FOR RESIDUE EDO A 159 source : AC4 11) chain A residue 124 type sequence G description BINDING SITE FOR RESIDUE EDO A 159 source : AC4 12) chain A residue 68 type sequence W description BINDING SITE FOR RESIDUE EDO A 160 source : AC5 13) chain A residue 28 type sequence Q description BINDING SITE FOR RESIDUE PG6 A 161 source : AC6 14) chain A residue 31 type sequence Y description BINDING SITE FOR RESIDUE PG6 A 161 source : AC6 15) chain A residue 34 type sequence W description BINDING SITE FOR RESIDUE PG6 A 161 source : AC6 16) chain A residue 65 type sequence E description BINDING SITE FOR RESIDUE PG6 A 161 source : AC6 17) chain A residue 68 type sequence W description BINDING SITE FOR RESIDUE PG6 A 161 source : AC6

Display surface Download Links