eF-site ID 3g53-A PDB Code 3g53 Chain A click to enlarge Title Ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloropropyl benzene bound to the XE4 cavity Classification OXYGEN BINDING Compound Globin-1 Source (GLB1_ANAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 2) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 3) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 4) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 5) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 6) chain A residue 110 type sequence E description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 7) chain A residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 8) chain A residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 9) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 10) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 11) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 12) chain A residue 21 type sequence S description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 13) chain A residue 22 type sequence W description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 14) chain A residue 25 type sequence I description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 15) chain A residue 32 type sequence N description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 16) chain A residue 36 type sequence L description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 17) chain A residue 74 type sequence M description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 18) chain A residue 121 type sequence V description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 19) chain A residue 122 type sequence L description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 20) chain A residue 135 type sequence W description BINDING SITE FOR RESIDUE LT1 A 150 source : AC3 21) chain A residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 22) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 23) chain A residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links