eF-site ID 3g4y-AB PDB Code 3g4y Chain A, B click to enlarge Title Ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloromethyl benzene bound to the XE4 cavity Classification OXYGEN BINDING Compound GLOBIN-1 Source null (GLB1_SCAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL B:  SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 2) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 3) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 4) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 5) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 6) chain A residue 110 type sequence E description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 7) chain A residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 8) chain B residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 9) chain B residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 10) chain A residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 11) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 12) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 13) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO A 148 source : AC2 14) chain A residue 25 type sequence I description BINDING SITE FOR RESIDUE 9CL A 151 source : AC3 15) chain A residue 74 type sequence M description BINDING SITE FOR RESIDUE 9CL A 151 source : AC3 16) chain A residue 121 type sequence V description BINDING SITE FOR RESIDUE 9CL A 151 source : AC3 17) chain A residue 135 type sequence W description BINDING SITE FOR RESIDUE 9CL A 151 source : AC3 18) chain A residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 19) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 20) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 21) chain B residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 22) chain B residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 23) chain B residue 77 type sequence L description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 24) chain B residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 25) chain B residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 26) chain B residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 27) chain B residue 110 type sequence E description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 28) chain B residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM B 147 source : AC4 29) chain B residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO B 148 source : AC5 30) chain B residue 51 type sequence F description BINDING SITE FOR RESIDUE CMO B 148 source : AC5 31) chain B residue 69 type sequence H description BINDING SITE FOR RESIDUE CMO B 148 source : AC5 32) chain B residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO B 148 source : AC5 33) chain B residue 25 type sequence I description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 34) chain B residue 74 type sequence M description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 35) chain B residue 77 type sequence L description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 36) chain B residue 121 type sequence V description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 37) chain B residue 122 type sequence L description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 38) chain B residue 135 type sequence W description BINDING SITE FOR RESIDUE 9CL B 150 source : AC6 39) chain A residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1 40) chain B residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links