eF-site ID 3fwc-M PDB Code 3fwc Chain M click to enlarge Title Sac3:Sus1:Cdc31 complex Classification cell cycle, transcription Compound Cell division control protein 31 Source null (SUS1_YEAST) Sequence M:  LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKAL GFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKR DPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDE ELRAMIEEFDLDGDGEINENEFIAICTD Description Functional site 1) chain M residue 43 type sequence H description BINDING SITE FOR RESIDUE SO4 M 162 source : AC4 2) chain M residue 58 type sequence K description BINDING SITE FOR RESIDUE SO4 M 162 source : AC4 3) chain M residue 33 type CROSSLNK sequence D description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 4) chain M residue 35 type CROSSLNK sequence N description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 5) chain M residue 37 type CROSSLNK sequence D description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 6) chain M residue 44 type CROSSLNK sequence E description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 7) chain M residue 142 type CROSSLNK sequence D description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 8) chain M residue 144 type CROSSLNK sequence D description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 9) chain M residue 146 type CROSSLNK sequence D description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 10) chain M residue 148 type CROSSLNK sequence E description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 11) chain M residue 153 type CROSSLNK sequence E description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI1 12) chain M residue 130 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links