eF-site ID 3fvr-D
PDB Code 3fvr
Chain D

click to enlarge
Title Crystal Structure of Acetyl Xylan Esterase from Bacillus pumilus, monoclinic crystal form I
Classification HYDROLASE
Compound Acetyl xylan esterase
Source Bacillus pumilus (Bacillus mesentericus) (Q9K5F2_BACPU)
Sequence D:  MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEA
EPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTG
PHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQ
GGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRA
LEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVV
VADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEK
AFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAA
YNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Description (1)  Crystal Structure of Acetyl Xylan Esterase from Bacillus pumilus, monoclinic crystal form I


Functional site

1) chain D
residue 104
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL C 322
source : AC6

2) chain D
residue 299
type
ligand
sequence E
description BINDING SITE FOR RESIDUE PG4 D 321
source : BC1

3) chain D
residue 300
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PG4 D 321
source : BC1

4) chain D
residue 141
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL D 322
source : BC2

5) chain D
residue 142
type
ligand
sequence I
description BINDING SITE FOR RESIDUE CL D 322
source : BC2

6) chain D
residue 143
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL D 322
source : BC2

7) chain D
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL D 323
source : BC3

8) chain D
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 323
source : BC3

9) chain D
residue 101
type binding
ligand PG4: TETRAETHYLENE GLYCOL
sequence D
description TETRAETHYLENE GLYCOL binding site
source pdb_hetatom : PG4_3fvr_D_321

10) chain D
residue 296
type binding
ligand PG4: TETRAETHYLENE GLYCOL
sequence F
description TETRAETHYLENE GLYCOL binding site
source pdb_hetatom : PG4_3fvr_D_321

11) chain D
residue 299-300
type binding
ligand PG4: TETRAETHYLENE GLYCOL
sequence EF
description TETRAETHYLENE GLYCOL binding site
source pdb_hetatom : PG4_3fvr_D_321

12) chain D
residue 302
type binding
ligand PG4: TETRAETHYLENE GLYCOL
sequence P
description TETRAETHYLENE GLYCOL binding site
source pdb_hetatom : PG4_3fvr_D_321

13) chain D
residue 100
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_3fvr_C_322

14) chain D
residue 104
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_3fvr_C_322

15) chain D
residue 181
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1odt
source CSA : CSA4

16) chain D
residue 269
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1odt
source CSA : CSA4

17) chain D
residue 298
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1odt
source CSA : CSA4

18) chain D
residue 182
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1odt
source CSA : CSA4

19) chain D
residue 181
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1odt
source CSA : CSA16

20) chain D
residue 298
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1odt
source CSA : CSA16

21) chain D
residue 269
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1odt
source CSA : CSA16


Display surface

Download
Links