eF-site ID 3fuy-ABC
PDB Code 3fuy
Chain A, B, C

click to enlarge
Title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS1
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Putative integron gene cassette protein
Source uncultured bacterium (B0BGB0_9BACT)
Sequence A:  SVNTSFLSPSLVTIRDFDNGQFAVLRIGRTGFPADKGDID
LCLDKXKGVRDAQQSIGDDTEFGFKGPHIRIRCVDIDDKH
TYNAXVYVDLIVGTGASEVERETAEELAKEKLRAALQVDI
ADEHSCVTQFEXKLREELLSSDSFHPDKDEYYKDFL
B:  ESVNTSFLSPSLVTIRDFDNGQFAVLRIGRTGFPADKGDI
DLCLDKXKGVRDAQQSIGDDTEFGFKGPHIRIRCVDIDDK
HTYNAXVYVDLIVGTGASEVERETAEELAKEKLRAALQVD
IADEHSCVTQFEXKLREELLSSDSFHPDKDEYYKDFL
C:  SVNTSFLSPSLVTIRDFDNGQFAVLRIGRTGFPADKGDID
LCLDKXKGVRDAQQSIGDDTEFGFKGPHIRIRCVDIDDKH
TYNAXVYVDLIVGTGASEVERETAEELAKEKLRAALQVDI
ADEHSCVTQFEXKLREELLSSDSFHPDKDEYYKDFL
Description (1)  Putative integron gene cassette protein


Functional site

1) chain A
residue 31
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 159
source : AC1

2) chain A
residue 81
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 159
source : AC1


Display surface

Download
Links