eF-site ID 3fur-AH PDB Code 3fur Chain A, H click to enlarge Title Crystal Structure of PPARg in complex with INT131 Classification TRANSCRIPTION/Transcription regulator Compound Peroxisome proliferator-activated receptor gamma Source (NCOA1_HUMAN) Sequence A:  PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKS PFVIYDMNSLMMGKEVAIRIFQGCQFRSVEAVQEITEYAK SIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLI SEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDD SDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQL KLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTET DMSLHPLLQEIYKDLY H:  TSHKLVQLLTTT Description Functional site 1) chain A residue 282 type sequence F description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 2) chain A residue 284 type sequence G description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 3) chain A residue 285 type sequence C description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 4) chain A residue 288 type sequence R description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 5) chain A residue 327 type sequence Y description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 6) chain A residue 330 type sequence L description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 7) chain A residue 341 type sequence I description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 8) chain A residue 363 type sequence F description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 9) chain A residue 364 type sequence M description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 10) chain A residue 367 type sequence K description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 11) chain A residue 449 type sequence H description BINDING SITE FOR RESIDUE Z12 A 1 source : AC1 12) chain A residue 356 type sequence L description BINDING SITE FOR RESIDUE CL A 478 source : AC2 13) chain A residue 357 type sequence R description BINDING SITE FOR RESIDUE CL A 478 source : AC2 14) chain A residue 429 type sequence S description BINDING SITE FOR RESIDUE CL A 478 source : AC2 15) chain A residue 430 type sequence Q description BINDING SITE FOR RESIDUE CL A 478 source : AC2 16) chain A residue 286 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI1 17) chain A residue 323 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI1 18) chain A residue 449 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI1 19) chain A residue 473 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI1 20) chain A residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:36737649 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links