eF-site ID 3fkz-A PDB Code 3fkz Chain A click to enlarge Title X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease Classification HYDROLASE Compound Ribonuclease pancreatic Source Bos taurus (Bovine) (RNAS1_BOVIN) Sequence A:  KETAAAKFERQHMDSGNSPSSSSNYCNQMMXXRNLTKDRC KPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF DASV Description Functional site 1) chain A residue 12 type catalytic sequence H description 164 source MCSA : MCSA1 2) chain A residue 41 type catalytic sequence K description 164 source MCSA : MCSA1 3) chain A residue 119 type catalytic sequence H description 164 source MCSA : MCSA1 4) chain A residue 120 type catalytic sequence F description 164 source MCSA : MCSA1 5) chain A residue 121 type catalytic sequence D description 164 source MCSA : MCSA1 6) chain A residue 1 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:4030761 source Swiss-Prot : SWS_FT_FI4 7) chain A residue 7 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:4030761 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 37 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:4030761 source Swiss-Prot : SWS_FT_FI4 9) chain A residue 41 type CARBOHYD sequence K description N-linked (Glc) (glycation) lysine; in vitro => ECO:0000269|PubMed:4030761 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 7 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 11) chain A residue 10 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 12) chain A residue 41 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 13) chain A residue 66 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 14) chain A residue 85 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 15) chain A residue 12 type ACT_SITE sequence H description Proton acceptor source Swiss-Prot : SWS_FT_FI1 16) chain A residue 119 type ACT_SITE sequence H description Proton donor source Swiss-Prot : SWS_FT_FI2 17) chain A residue 40-46 type prosite sequence CKPVNTF description RNASE_PANCREATIC Pancreatic ribonuclease family signature. CKpvNTF source prosite : PS00127 18) chain A residue 34 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine; partial => ECO:0000269|PubMed:19358553 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links