eF-site ID 3fky-A PDB Code 3fky Chain A click to enlarge Title Crystal structure of the glutamine synthetase Gln1deltaN18 from the yeast Saccharomyces cerevisiae Classification LIGASE Compound Glutamine synthetase Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (GLNA_YEAST) Sequence A:  RGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFD GSSTNQAPGHDIYLKPVAYYPDPFRRGDNIVVLAACYNND GTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDD VYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLY AGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFL HRVAEEFGIKISFHPKPLKGDWNGAGCHANVSTKEMRQPG GTKYIEQAIEKLSKRHAEHIKLYGSDNDMRSMTAFSSGVA NRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCE TVCGAIDNADMTKEFE Description Functional site 1) chain A residue 133 type sequence E description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 2) chain A residue 193 type sequence E description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 3) chain A residue 198 type sequence Q description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 4) chain A residue 245 type sequence N description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 5) chain A residue 246 type sequence G description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 6) chain A residue 247 type sequence A description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 7) chain A residue 250 type sequence H description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 8) chain A residue 292 type sequence R description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 9) chain A residue 333 type sequence R description BINDING SITE FOR RESIDUE FLC A 371 source : AC1 10) chain A residue 59-76 type prosite sequence FDGSSTNQAPGHDIYL description GLNA_1 Glutamine synthetase signature 1. FDGSStnqapgh.DSDiyL source prosite : PS00180 11) chain A residue 238-254 type prosite sequence KPLKGDWNGAGCHANVS description GLNA_ATP Glutamine synthetase putative ATP-binding region signature. KPLkgdw.NGAGcHanvS source prosite : PS00181 12) chain A residue 283 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 324 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 363 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links