eF-site ID 3ff5-AB PDB Code 3ff5 Chain A, B click to enlarge Title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix-protein-import receptor, Pex14p Classification PROTEIN TRANSPORT Compound Peroxisomal biogenesis factor 14 Source null (Q642G4_RAT) Sequence A:  GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKK GLTDEEIDLAFQQS B:  GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKK GLTDEEIDLAFQQS Description Functional site 1) chain A residue 52 type sequence F description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 2) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 3) chain B residue 18 type sequence P description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 4) chain B residue 20 type sequence G description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 5) chain B residue 21 type sequence S description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 6) chain B residue 52 type sequence F description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 7) chain B residue 55 type sequence K description BINDING SITE FOR RESIDUE DPW A 1 source : AC1 8) chain A residue 34 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O75381 source Swiss-Prot : SWS_FT_FI1 9) chain B residue 34 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O75381 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links