eF-site ID 3fc9-C PDB Code 3fc9 Chain C Title Crystal structure of the Mimivirus NDK +Kpn-N62L double mutant complexed with CDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence C:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain C residue 119 type sequence D description BINDING SITE FOR RESIDUE MG C 142 source : AC4 2) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 3) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 4) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 5) chain C residue 62 type sequence L description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 6) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 7) chain C residue 92 type sequence T description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 8) chain C residue 103 type sequence R description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 9) chain C residue 110 type sequence I description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 10) chain C residue 111 type sequence R description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 11) chain C residue 113 type sequence N description BINDING SITE FOR RESIDUE CDP C 143 source : AC5 12) chain C residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 13) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 14) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 15) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 16) chain C residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 17) chain C residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links