eF-site ID 3fc9-ABF PDB Code 3fc9 Chain A, B, F click to enlarge Title Crystal structure of the Mimivirus NDK +Kpn-N62L double mutant complexed with CDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence A:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFPE B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFP F:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 2) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 3) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 4) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 5) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 6) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 7) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 8) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 9) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 10) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 11) chain A residue 119 type sequence D description BINDING SITE FOR RESIDUE CTP A 142 source : AC1 12) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 13) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 14) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 15) chain B residue 62 type sequence L description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 16) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 17) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 18) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 19) chain B residue 110 type sequence I description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 20) chain B residue 111 type sequence R description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 21) chain B residue 113 type sequence N description BINDING SITE FOR RESIDUE CDP B 143 source : AC3 22) chain F residue 86 type sequence R description BINDING SITE FOR RESIDUE MG F 142 source : BC1 23) chain F residue 9 type sequence K description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 24) chain F residue 53 type sequence H description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 25) chain F residue 58 type sequence Y description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 26) chain F residue 62 type sequence L description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 27) chain F residue 86 type sequence R description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 28) chain F residue 92 type sequence T description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 29) chain F residue 103 type sequence R description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 30) chain F residue 110 type sequence I description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 31) chain F residue 111 type sequence R description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 32) chain F residue 113 type sequence N description BINDING SITE FOR RESIDUE CDP F 143 source : BC2 33) chain A residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 34) chain B residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 35) chain F residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 37) chain B residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 38) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 39) chain F residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 40) chain F residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 41) chain F residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 42) chain F residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 43) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 44) chain F residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 45) chain A residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 46) chain A residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 47) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 48) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 49) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 50) chain B residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469

Display surface Download Links