eF-site ID 3fbf-E PDB Code 3fbf Chain E click to enlarge Title Crystal structure of the Mimivirus NDK N62L mutant complexed with dTDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source null (NDK_MIMIV) Sequence E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 2) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 3) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 4) chain E residue 62 type sequence L description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 5) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 6) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 7) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 8) chain E residue 107 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 9) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 10) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 11) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 12) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 13) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 14) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 15) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links