eF-site ID 3fbf-ACE PDB Code 3fbf Chain A, C, E click to enlarge Title Crystal structure of the Mimivirus NDK N62L mutant complexed with dTDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence A:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSA VDEISIWFPE C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 160 source : AC1 2) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 3) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 4) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 5) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 6) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 7) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 8) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 9) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 10) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 11) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 12) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE MG C 162 source : AC5 13) chain C residue 115 type sequence D description BINDING SITE FOR RESIDUE MG C 162 source : AC5 14) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 15) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 16) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 17) chain C residue 62 type sequence L description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 18) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 19) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 20) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 21) chain C residue 107 type sequence R description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 22) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD C 138 source : AC6 23) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 24) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 25) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 26) chain E residue 62 type sequence L description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 27) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 28) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 29) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 30) chain E residue 107 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 31) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD E 138 source : BC1 32) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 33) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 34) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 35) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 37) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 38) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 39) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 40) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 41) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 42) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 43) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 44) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 45) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 46) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 47) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 48) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 49) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 50) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links