eF-site ID 3fbe-BDF PDB Code 3fbe Chain B, D, F click to enlarge Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with GDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSA VDEISIWFP D:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET F:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFP Description Functional site 1) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 2) chain B residue 62 type sequence L description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 3) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 4) chain B residue 89 type sequence Q description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 5) chain B residue 90 type sequence G description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 6) chain B residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 7) chain B residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP B 138 source : AC3 8) chain D residue 9 type sequence K description BINDING SITE FOR RESIDUE MG D 163 source : AC6 9) chain D residue 50 type sequence Y description BINDING SITE FOR RESIDUE MG D 163 source : AC6 10) chain D residue 112 type sequence H description BINDING SITE FOR RESIDUE MG D 163 source : AC6 11) chain D residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 12) chain D residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 13) chain D residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 14) chain D residue 62 type sequence L description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 15) chain D residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 16) chain D residue 89 type sequence Q description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 17) chain D residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 18) chain D residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 19) chain D residue 107 type sequence G description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 20) chain D residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP D 138 source : AC7 21) chain F residue 86 type sequence R description BINDING SITE FOR RESIDUE MG F 165 source : BC1 22) chain F residue 115 type sequence D description BINDING SITE FOR RESIDUE MG F 165 source : BC1 23) chain F residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 24) chain F residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 25) chain F residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 26) chain F residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 27) chain F residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 28) chain F residue 107 type sequence G description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 29) chain F residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP F 138 source : BC2 30) chain B residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 31) chain D residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 32) chain D residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 33) chain D residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 34) chain D residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 35) chain D residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 36) chain F residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 37) chain F residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 38) chain F residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 39) chain F residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 40) chain F residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 41) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 42) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 43) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 44) chain B residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 45) chain B residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 46) chain D residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 47) chain F residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links