eF-site ID 3fbe-ACE PDB Code 3fbe Chain A, C, E click to enlarge Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with GDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFW SKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEG TDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSED SAVDEISIWFPET C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE MG A 160 source : AC1 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE MG A 160 source : AC1 3) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE MG A 160 source : AC1 4) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 5) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 6) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 7) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 8) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 9) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 10) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 11) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 12) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP A 138 source : AC2 13) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE MG C 162 source : AC4 14) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 15) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 16) chain C residue 62 type sequence L description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 17) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 18) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 19) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 20) chain C residue 107 type sequence G description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 21) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP C 138 source : AC5 22) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE MG E 164 source : AC8 23) chain E residue 115 type sequence D description BINDING SITE FOR RESIDUE MG E 164 source : AC8 24) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 25) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 26) chain E residue 62 type sequence L description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 27) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 28) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 29) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 30) chain E residue 107 type sequence G description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 31) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE GDP E 138 source : AC9 32) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 33) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 34) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 35) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 36) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 37) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 38) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 39) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 40) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 41) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 42) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 43) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 44) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 45) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 46) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 47) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 48) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 49) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 50) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469

Display surface Download Links