eF-site ID 3fbc-A
PDB Code 3fbc
Chain A

click to enlarge
Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with dTDP
Classification TRANSFERASE
Compound Nucleoside diphosphate kinase
Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV)
Sequence A:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS
KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT
DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS
AVDEISIWFPE
Description (1)  Nucleoside diphosphate kinase (E.C.2.7.4.6)


Functional site

1) chain A
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MG A 160
source : AC1

2) chain A
residue 115
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 160
source : AC1

3) chain A
residue 9
type
ligand
sequence K
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

4) chain A
residue 53
type
ligand
sequence H
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

5) chain A
residue 58
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

6) chain A
residue 62
type
ligand
sequence L
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

7) chain A
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

8) chain A
residue 99
type
ligand
sequence R
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

9) chain A
residue 106
type
ligand
sequence I
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

10) chain A
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

11) chain A
residue 109
type
ligand
sequence N
description BINDING SITE FOR RESIDUE TYD A 138
source : AC2

12) chain A
residue 90
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 A 139
source : AC3

13) chain A
residue 91
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PO4 A 139
source : AC3

14) chain A
residue 92
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PO4 A 139
source : AC3

15) chain A
residue 99
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PO4 A 139
source : AC3

16) chain A
residue 109
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PO4 A 139
source : AC3

17) chain A
residue 117
type ACT_SITE
ligand
sequence E
description Pros-phosphohistidine intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 14
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 63
type BINDING
ligand
sequence C
description ATP.
source Swiss-Prot : SWS_FT_FI2

20) chain A
residue 91
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI2

21) chain A
residue 104
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI2

22) chain A
residue 114
type BINDING
ligand
sequence S
description ATP.
source Swiss-Prot : SWS_FT_FI2

23) chain A
residue 109-117
type prosite
ligand
sequence NLIHASDSE
description Nucleoside diphosphate kinases active site. N-x(2)-H-[GA]-S-D-[GSA]-[LIVMPKNE]
source prosite : PS00469

24) chain A
residue 9
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence K
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

25) chain A
residue 50
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence Y
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

26) chain A
residue 53
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence H
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

27) chain A
residue 58
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence Y
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

28) chain A
residue 62
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence L
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

29) chain A
residue 86
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence R
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

30) chain A
residue 89
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence Q
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

31) chain A
residue 99
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence R
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

32) chain A
residue 106-107
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence IG
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

33) chain A
residue 109
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence N
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

34) chain A
residue 111-112
type binding
ligand TYD: THYMIDINE-5'-DIPHOSPHATE
sequence IH
description THYMIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : TYD_3fbc_A_138

35) chain A
residue 109
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1nsp
source CSA : CSA1

36) chain A
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA1

37) chain A
residue 50
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1nsp
source CSA : CSA7

38) chain A
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA7


Display surface

Download
Links