eF-site ID 3fbc-A PDB Code 3fbc Chain A click to enlarge Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with dTDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPE Description Functional site 1) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 160 source : AC1 2) chain A residue 115 type sequence D description BINDING SITE FOR RESIDUE MG A 160 source : AC1 3) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 4) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 5) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 6) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 7) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 8) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 9) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 10) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 11) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD A 138 source : AC2 12) chain A residue 90 type sequence G description BINDING SITE FOR RESIDUE PO4 A 139 source : AC3 13) chain A residue 91 type sequence N description BINDING SITE FOR RESIDUE PO4 A 139 source : AC3 14) chain A residue 92 type sequence I description BINDING SITE FOR RESIDUE PO4 A 139 source : AC3 15) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE PO4 A 139 source : AC3 16) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE PO4 A 139 source : AC3 17) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 18) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links