eF-site ID 3fbb-E
PDB Code 3fbb
Chain E

click to enlarge
Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with UDP
Classification TRANSFERASE
Compound Nucleoside diphosphate kinase
Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV)
Sequence E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS
KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT
DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS
AVDEISIWFPET
Description (1)  Nucleoside diphosphate kinase (E.C.2.7.4.6)


Functional site

1) chain E
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MG E 202
source : AC9

2) chain E
residue 115
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG E 202
source : AC9

3) chain E
residue 9
type
ligand
sequence K
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

4) chain E
residue 53
type
ligand
sequence H
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

5) chain E
residue 58
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

6) chain E
residue 62
type
ligand
sequence L
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

7) chain E
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

8) chain E
residue 99
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

9) chain E
residue 106
type
ligand
sequence I
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

10) chain E
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

11) chain E
residue 109
type
ligand
sequence N
description BINDING SITE FOR RESIDUE UDP E 201
source : BC1

12) chain E
residue 117
type ACT_SITE
ligand
sequence E
description Pros-phosphohistidine intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI9

13) chain E
residue 14
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI10

14) chain E
residue 63
type BINDING
ligand
sequence C
description ATP.
source Swiss-Prot : SWS_FT_FI10

15) chain E
residue 91
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI10

16) chain E
residue 104
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI10

17) chain E
residue 114
type BINDING
ligand
sequence S
description ATP.
source Swiss-Prot : SWS_FT_FI10

18) chain E
residue 109-117
type prosite
ligand
sequence NLIHASDSE
description Nucleoside diphosphate kinases active site. N-x(2)-H-[GA]-S-D-[GSA]-[LIVMPKNE]
source prosite : PS00469

19) chain E
residue 9
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence K
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

20) chain E
residue 50
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Y
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

21) chain E
residue 53
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence H
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

22) chain E
residue 58
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Y
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

23) chain E
residue 62
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence L
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

24) chain E
residue 86
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence R
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

25) chain E
residue 89
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Q
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

26) chain E
residue 99
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence R
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

27) chain E
residue 106-109
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence IGEN
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

28) chain E
residue 111-112
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence IH
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_E_201

29) chain E
residue 109
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1nsp
source CSA : CSA5

30) chain E
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA5

31) chain E
residue 50
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1nsp
source CSA : CSA11

32) chain E
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA11


Display surface

Download
Links