eF-site ID 3fbb-C
PDB Code 3fbb
Chain C

click to enlarge
Title Crystal structure of the Mimivirus NDK N62L-R107G double mutant complexed with UDP
Classification TRANSFERASE
Compound Nucleoside diphosphate kinase
Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV)
Sequence C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS
KAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGT
DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS
AVDEISIWFPET
Description (1)  Nucleoside diphosphate kinase (E.C.2.7.4.6)


Functional site

1) chain C
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MG C 202
source : AC5

2) chain C
residue 115
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG C 202
source : AC5

3) chain C
residue 9
type
ligand
sequence K
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

4) chain C
residue 53
type
ligand
sequence H
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

5) chain C
residue 58
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

6) chain C
residue 62
type
ligand
sequence L
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

7) chain C
residue 86
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

8) chain C
residue 89
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

9) chain C
residue 99
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

10) chain C
residue 106
type
ligand
sequence I
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

11) chain C
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

12) chain C
residue 109
type
ligand
sequence N
description BINDING SITE FOR RESIDUE UDP C 201
source : AC6

13) chain C
residue 117
type ACT_SITE
ligand
sequence E
description Pros-phosphohistidine intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI5

14) chain C
residue 14
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI6

15) chain C
residue 63
type BINDING
ligand
sequence C
description ATP.
source Swiss-Prot : SWS_FT_FI6

16) chain C
residue 91
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI6

17) chain C
residue 104
type BINDING
ligand
sequence N
description ATP.
source Swiss-Prot : SWS_FT_FI6

18) chain C
residue 114
type BINDING
ligand
sequence S
description ATP.
source Swiss-Prot : SWS_FT_FI6

19) chain C
residue 109-117
type prosite
ligand
sequence NLIHASDSE
description Nucleoside diphosphate kinases active site. N-x(2)-H-[GA]-S-D-[GSA]-[LIVMPKNE]
source prosite : PS00469

20) chain C
residue 9
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence K
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

21) chain C
residue 50
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Y
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

22) chain C
residue 53
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence H
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

23) chain C
residue 58
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Y
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

24) chain C
residue 62
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence L
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

25) chain C
residue 86
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence R
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

26) chain C
residue 89
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence Q
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

27) chain C
residue 99
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence R
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

28) chain C
residue 106-109
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence IGEN
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

29) chain C
residue 111-112
type binding
ligand UDP: URIDINE-5'-DIPHOSPHATE
sequence IH
description URIDINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : UDP_3fbb_C_201

30) chain C
residue 109
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1nsp
source CSA : CSA3

31) chain C
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA3

32) chain C
residue 50
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1nsp
source CSA : CSA9

33) chain C
residue 9
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1nsp
source CSA : CSA9


Display surface

Download
Links