eF-site ID 3f8a-A PDB Code 3f8a Chain A click to enlarge Title Crystal Structure of the R132K:R111L:L121E:R59W Mutant of Cellular Retinoic Acid-Binding Protein Type II Complexed with C15-aldehyde (a retinal analog) at 1.95 Angstrom resolution. Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPA VEIKQEGDTFYIKTSTTVWTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELI ETMTADDVVCTKVYVRE Description Functional site 1) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 2) chain A residue 63 type sequence I description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 3) chain A residue 73 type sequence E description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 4) chain A residue 109 type sequence W description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 5) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 6) chain A residue 123 type sequence M description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 7) chain A residue 132 type sequence K description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 8) chain A residue 134 type sequence Y description BINDING SITE FOR RESIDUE B3P A 138 source : AC1 9) chain A residue 15 type sequence F description BINDING SITE FOR RESIDUE LSR A 139 source : AC2 10) chain A residue 32 type sequence A description BINDING SITE FOR RESIDUE LSR A 139 source : AC2 11) chain A residue 56 type sequence T description BINDING SITE FOR RESIDUE LSR A 139 source : AC2 12) chain A residue 132 type sequence K description BINDING SITE FOR RESIDUE LSR A 139 source : AC2 13) chain A residue 132 type BINDING sequence K description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214

Display surface Download Links