eF-site ID 3eze-A
PDB Code 3eze
Chain A

click to enlarge
Title COMPLEX OF THE AMINO TERMINAL DOMAIN OF ENZYME I AND THE HISTIDINE-CONTAINING PHOSPHOCARRIER PROTEIN HPR FROM ESCHERICHIA COLI NMR, RESTRAINED REGULARIZED MEAN STRUCTURE
Classification TRANSFERASE
Compound PROTEIN (PHOSPHOTRANSFERASE SYSTEM, ENZYME I)
Source Escherichia coli (strain K12) (PTHP_ECOLI)
Sequence A:  MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEV
ERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELP
AIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASE
Description (1)  PHOSPHOTRANSFERASE SYSTEM, ENZYME I/PHOSPHOTRANSFERASE SYSTEM, HPR


Functional site

1) chain A
residue 189
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PO3 B 600
source : AC1

2) chain A
residue 189
type ACT_SITE
ligand
sequence H
description Tele-phosphohistidine intermediate.
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 69
type binding
ligand PO3: PHOSPHITE ION
sequence K
description PHOSPHITE ION binding site
source pdb_hetatom : PO3_3eze_B_600

4) chain A
residue 72
type binding
ligand PO3: PHOSPHITE ION
sequence I
description PHOSPHITE ION binding site
source pdb_hetatom : PO3_3eze_B_600

5) chain A
residue 189
type binding
ligand PO3: PHOSPHITE ION
sequence H
description PHOSPHITE ION binding site
source pdb_hetatom : PO3_3eze_B_600

6) chain A
residue 192
type binding
ligand PO3: PHOSPHITE ION
sequence I
description PHOSPHITE ION binding site
source pdb_hetatom : PO3_3eze_B_600

7) chain A
residue 189
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1zym
source CSA : CSA1

8) chain A
residue 168
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1zym
source CSA : CSA1


Display surface

Download
Links