eF-site ID 3evw-D PDB Code 3evw Chain D click to enlarge Title Crystal structure of the Mimivirus NDK R107G mutant complexed with dTDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence D:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain D residue 86 type sequence R description BINDING SITE FOR RESIDUE MG D 163 source : AC4 2) chain D residue 115 type sequence D description BINDING SITE FOR RESIDUE MG D 163 source : AC4 3) chain D residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 4) chain D residue 50 type sequence Y description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 5) chain D residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 6) chain D residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 7) chain D residue 62 type sequence N description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 8) chain D residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 9) chain D residue 89 type sequence Q description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 10) chain D residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 11) chain D residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 12) chain D residue 107 type sequence G description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 13) chain D residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD D 138 source : BC1 14) chain D residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 15) chain D residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 16) chain D residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain D residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 18) chain D residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 19) chain D residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links