eF-site ID 3evw-ACE PDB Code 3evw Chain A, C, E click to enlarge Title Crystal structure of the Mimivirus NDK R107G mutant complexed with dTDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence A:  AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFW SKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEG TDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSED SAVDEISIWFPET C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 160 source : AC1 2) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE MG C 162 source : AC3 3) chain C residue 115 type sequence D description BINDING SITE FOR RESIDUE MG C 162 source : AC3 4) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE MG E 164 source : AC5 5) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 6) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 7) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 8) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 9) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 10) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 11) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 12) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 13) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 14) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 15) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD A 138 source : AC7 16) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 17) chain C residue 50 type sequence Y description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 18) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 19) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 20) chain C residue 62 type sequence N description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 21) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 22) chain C residue 89 type sequence Q description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 23) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 24) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 25) chain C residue 107 type sequence G description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 26) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD C 138 source : AC9 27) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 28) chain E residue 50 type sequence Y description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 29) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 30) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 31) chain E residue 62 type sequence N description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 32) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 33) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 34) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 35) chain E residue 107 type sequence G description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 36) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE TYD E 138 source : BC2 37) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 38) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 39) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 40) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 41) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 42) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 43) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 44) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 45) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 46) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 47) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 48) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 49) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 50) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 51) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 52) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 53) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 54) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 55) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links