eF-site ID 3etm-AB PDB Code 3etm Chain A, B click to enlarge Title Crystal structure of the mimivirus NDK +KPN-N62L-R107G triple mutant complexed with CDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKA PRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDA ISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSE DSAVDEISIWFPE B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 2) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 3) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 4) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 5) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 6) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 7) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 8) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 9) chain A residue 111 type sequence G description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 10) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE CDP A 201 source : AC2 11) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 12) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 13) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 14) chain B residue 62 type sequence L description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 15) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 16) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 17) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 18) chain B residue 110 type sequence I description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 19) chain B residue 111 type sequence G description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 20) chain B residue 113 type sequence N description BINDING SITE FOR RESIDUE CDP B 201 source : AC4 21) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 22) chain A residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 23) chain B residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 25) chain B residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 29) chain A residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 30) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 31) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 32) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 33) chain B residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links