eF-site ID 3esd-A PDB Code 3esd Chain A click to enlarge Title cut-2b; NCN-Pt-Pincer-Cutinase Hybrid Classification HYDROLASE Compound Cutinase 1 Source Fusarium solani subsp. pisi (Nectria haematococca) (CUTI1_FUSSO) Sequence A:  RTTRDDLINGNSASCADVIFIYARGSTETGNLGTLGPSIA SNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIR EMLGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLDSA IRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCKTGDL VCTGSLIVAAPHLAYGPDARGPAPEFLIEKVRAVR Description Functional site 1) chain A residue 42 type sequence S description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 2) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 3) chain A residue 82 type sequence G description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 4) chain A residue 84 type sequence N description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 5) chain A residue 119 type sequence Y description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 6) chain A residue 120 type sequence S description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 7) chain A residue 121 type sequence Q description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 8) chain A residue 182 type sequence L description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 9) chain A residue 183 type sequence I description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 10) chain A residue 188 type sequence H description BINDING SITE FOR RESIDUE SXC A 215 source : AC1 11) chain A residue 42 type catalytic sequence S description 631 source MCSA : MCSA1 12) chain A residue 120 type catalytic sequence S description 631 source MCSA : MCSA1 13) chain A residue 121 type catalytic sequence Q description 631 source MCSA : MCSA1 14) chain A residue 175 type catalytic sequence D description 631 source MCSA : MCSA1 15) chain A residue 188 type catalytic sequence H description 631 source MCSA : MCSA1 16) chain A residue 110-122 type prosite sequence PDATLIAGGYSQG description CUTINASE_1 Cutinase, serine active site. PdAtLIaGGYSQG source prosite : PS00155 17) chain A residue 171-188 type prosite sequence CKTGDLVCTGSLIVAAPH description CUTINASE_2 Cutinase, aspartate and histidine active sites. CktgDlVCtGSliVaapH source prosite : PS00931 18) chain A residue 175 type ACT_SITE sequence D description ACT_SITE => ECO:0000269|PubMed:1560844, ECO:0007744|PDB:1AGY source Swiss-Prot : SWS_FT_FI2 19) chain A residue 188 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000269|PubMed:1560844, ECO:0007744|PDB:1AGY source Swiss-Prot : SWS_FT_FI3 20) chain A residue 42 type SITE sequence S description Transition state stabilizer => ECO:0000269|PubMed:1560844, ECO:0000269|PubMed:8286366, ECO:0000269|PubMed:8555209, ECO:0000269|PubMed:9041628, ECO:0007744|PDB:1AGY, ECO:0007744|PDB:1FFE, ECO:0007744|PDB:1OXM, ECO:0007744|PDB:2CUT source Swiss-Prot : SWS_FT_FI4 21) chain A residue 121 type SITE sequence Q description Transition state stabilizer => ECO:0000269|PubMed:1560844, ECO:0000269|PubMed:8286366, ECO:0000269|PubMed:9041628, ECO:0007744|PDB:1AGY, ECO:0007744|PDB:1OXM, ECO:0007744|PDB:2CUT source Swiss-Prot : SWS_FT_FI5 22) chain A residue 120 type ACT_SITE sequence S description Nucleophile => ECO:0000269|PubMed:1560844, ECO:0007744|PDB:1AGY source Swiss-Prot : SWS_FT_FI1

Display surface Download Links