eF-site ID 3ena-AB PDB Code 3ena Chain A, B click to enlarge Title Crystal structure of the mimivirus NDK +Kpn-N62L-R107G triple mutant complexed with dGDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDS EDSAVDEISIWFPE B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 3) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 4) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 5) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 6) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 7) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 8) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 9) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 10) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE DGI A 201 source : AC1 11) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 12) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 13) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 14) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 15) chain B residue 62 type sequence L description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 16) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 17) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 18) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 19) chain B residue 110 type sequence I description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 20) chain B residue 113 type sequence N description BINDING SITE FOR RESIDUE DGI B 201 source : AC3 21) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 22) chain B residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 27) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 28) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 29) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 30) chain B residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 31) chain A residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 32) chain B residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469

Display surface Download Links