eF-site ID 3emt-AB PDB Code 3emt Chain A, B click to enlarge Title Crystal structure of the mimivirus NDK +Kpn-R107G double mutant complexed with dGDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence A:  QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKA PRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDA ISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSE DSAVDEISIWFPE B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 3) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 4) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 5) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 6) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 7) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 8) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 9) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE DGI A 201 source : AC2 10) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 11) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 12) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 13) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 14) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 15) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 16) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 17) chain B residue 110 type sequence I description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 18) chain B residue 113 type sequence N description BINDING SITE FOR RESIDUE DGI B 201 source : AC4 19) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 20) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 21) chain B residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 26) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 27) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 28) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 29) chain B residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 30) chain A residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 31) chain B residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links