eF-site ID 3elh-E PDB Code 3elh Chain E click to enlarge Title X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dUDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 2) chain E residue 50 type sequence Y description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 3) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 4) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 5) chain E residue 62 type sequence N description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 6) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 7) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 8) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 9) chain E residue 107 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 10) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 11) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE MG E 165 source : BC1 12) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 13) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 14) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 15) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 16) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links