eF-site ID 3elh-ACE PDB Code 3elh Chain A, C, E click to enlarge Title X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dUDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFW SKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEG TDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSED SAVDEISIWFPET C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 2) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 3) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 4) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 5) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 6) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 7) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 8) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 9) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 10) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 11) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 161 source : AC2 12) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 13) chain C residue 50 type sequence Y description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 14) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 15) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 16) chain C residue 62 type sequence N description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 17) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 18) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 19) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 20) chain C residue 107 type sequence R description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 21) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE DUD C 162 source : AC5 22) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE MG C 163 source : AC6 23) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 24) chain E residue 50 type sequence Y description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 25) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 26) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 27) chain E residue 62 type sequence N description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 28) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 29) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 30) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 31) chain E residue 107 type sequence R description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 32) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE DUD E 164 source : AC9 33) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE MG E 165 source : BC1 34) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 35) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 36) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 37) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 39) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 40) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 41) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 42) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 43) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 44) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 45) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 46) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 47) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 48) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 49) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 50) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 51) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 52) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links