eF-site ID 3elh-A PDB Code 3elh Chain A click to enlarge Title X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dUDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source (NDK_MIMIV) Sequence A:  AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFW SKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEG TDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSED SAVDEISIWFPET Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 2) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 3) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 4) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 5) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 6) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 7) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 8) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 9) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 10) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE DUD A 160 source : AC1 11) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 161 source : AC2 12) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469

Display surface Download Links