eF-site ID 3ejm-AB PDB Code 3ejm Chain A, B click to enlarge Title Crystal structure of the mimivirus NDK +Kpn mutant complexed with GDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source null (NDK_MIMIV) Sequence A:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFPE B:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDS EDSAVDEISIWFPE Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 3) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 4) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 5) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 6) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 7) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 8) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 9) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 10) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 11) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 12) chain B residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 13) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 14) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 15) chain B residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 16) chain B residue 62 type sequence N description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 17) chain B residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 18) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 19) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 20) chain B residue 110 type sequence I description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 21) chain B residue 111 type sequence R description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 22) chain B residue 113 type sequence N description BINDING SITE FOR RESIDUE GDP B 202 source : AC3 23) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 24) chain A residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 25) chain B residue 112 type ACT_SITE sequence E description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 29) chain A residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 30) chain A residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 31) chain B residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 32) chain B residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 33) chain B residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 34) chain B residue 109 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 35) chain B residue 99 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links