eF-site ID 3ej2-A PDB Code 3ej2 Chain A click to enlarge Title Crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei with bound 5-amino-1-(4-chlorophenyl)-1h-pyrazole-4-carbonitrile, H32 crystal form Classification HYDROLASE Compound Inorganic pyrophosphatase Source Burkholderia pseudomallei (strain 1710b) (Q3JUV5_BURP1) Sequence A:  MGTLEAQMSFSNVPAGKDLPQDFNVIIEIPAQSEPVKYEA DKALGLLVVDRFIGTGMRYPVNYGFIPQTLSGDGDPVDVL VITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDK VCPMTANLKSIDDVPAYLKDQIKHFFEQYKALEKGKWVKV EGWDGIDAAHKEITDGVANFKK Description Functional site 1) chain A residue 75 type sequence I description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 2) chain A residue 76 type sequence T description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 3) chain A residue 77 type sequence P description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 4) chain A residue 117 type sequence M description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 5) chain A residue 118 type sequence T description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 6) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 7) chain A residue 128 type sequence P description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 8) chain A residue 130 type sequence Y description BINDING SITE FOR RESIDUE 928 A 176 source : AC1 9) chain A residue 66-72 type prosite sequence DGDPVDV description PPASE Inorganic pyrophosphatase signature. DGDPVDV source prosite : PS00387

Display surface Download Links