eF-site ID 3eic-C PDB Code 3eic Chain C click to enlarge Title X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with UDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET Description Functional site 1) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE MG C 162 source : AC3 2) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 3) chain C residue 50 type sequence Y description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 4) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 5) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 6) chain C residue 62 type sequence N description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 7) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 8) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 9) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 10) chain C residue 107 type sequence R description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 11) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE UDP C 163 source : AC9 12) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 13) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 14) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 15) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 16) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links