eF-site ID 3eg1-AB PDB Code 3eg1 Chain A, B click to enlarge Title Crystal structure of the N114Q mutant of ABL-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions Classification Transferase/Signaling protein Compound Proto-oncogene tyrosine-protein kinase ABL1 Source null (3EG1) Sequence A:  NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQ TKNGQGWVPSQYITPVNS B:  NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQ TKNGQGWVPSQYITPV Description Functional site 1) chain A residue 110 type sequence W description BINDING SITE FOR RESIDUE ACE C 0 source : AC1 2) chain B residue 89 type sequence R description BINDING SITE FOR RESIDUE ACE C 0 source : AC1 3) chain B residue 103 type sequence Q description BINDING SITE FOR RESIDUE ACE C 0 source : AC1 4) chain A residue 103 type sequence Q description BINDING SITE FOR RESIDUE ACE D 0 source : AC2 5) chain B residue 78 type sequence N description BINDING SITE FOR RESIDUE ACE D 0 source : AC2 6) chain B residue 110 type sequence W description BINDING SITE FOR RESIDUE ACE D 0 source : AC2 7) chain A residue 94 type sequence N description BINDING SITE FOR RESIDUE SO4 A 2 source : AC3 8) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE SO4 A 2 source : AC3 9) chain B residue 89 type sequence R description BINDING SITE FOR RESIDUE SO4 A 2 source : AC3 10) chain B residue 94 type sequence N description BINDING SITE FOR RESIDUE SO4 B 1 source : AC4 11) chain B residue 95 type sequence H description BINDING SITE FOR RESIDUE SO4 B 1 source : AC4 12) chain A residue 70 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16912036, ECO:0000269|PubMed:18775435 source Swiss-Prot : SWS_FT_FI1 13) chain B residue 70 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:16912036, ECO:0000269|PubMed:18775435 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 115 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2 15) chain B residue 115 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links