eF-site ID 3e9j-C PDB Code 3e9j Chain C click to enlarge Title Structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB Classification OXIDOREDUCTASE Compound Thiol/disulfide oxidoreductase DsbA Source Escherichia coli (strain K12) (DSBB_ECOLI) Sequence C:  AWLLMAFTALALELTALWFQHVMLLKPCVLCIYERVALFG VLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTM LQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVAMPQWLLG IFIAYLIVAVLVVI Description Functional site 1) chain C residue 39 type sequence K description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 2) chain C residue 41 type sequence C description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 3) chain C residue 44 type sequence C description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 4) chain C residue 47 type sequence E description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 5) chain C residue 48 type sequence R description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 6) chain C residue 91 type sequence H description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 7) chain C residue 142 type sequence M description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 8) chain C residue 146 type sequence L description BINDING SITE FOR RESIDUE UQ1 C 501 source : AC1 9) chain C residue 41 type catalytic sequence C description 734 source MCSA : MCSA1 10) chain C residue 44 type catalytic sequence C description 734 source MCSA : MCSA1 11) chain C residue 48 type catalytic sequence R description 734 source MCSA : MCSA1 12) chain C residue 104 type catalytic sequence C description 734 source MCSA : MCSA1 13) chain C residue 66-71 type TOPO_DOM sequence KTPLRY description Cytoplasmic => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 14) chain C residue 15-31 type TRANSMEM sequence WLLMAFTALALELTALW description Helical => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 15) chain C residue 50-65 type TRANSMEM sequence ALFGVLGAALIGAIAP description Helical => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 16) chain C residue 72-89 type TRANSMEM sequence VAMVIWLYSAFRGVQLTY description Helical => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 17) chain C residue 32-49 type TOPO_DOM sequence FQHVMLLKPCVLCIYERV description Periplasmic => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 18) chain C residue 90-144 type TOPO_DOM sequence EHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVAMPQ description Periplasmic => ECO:0000305 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links