eF-site ID 3e8u-L
PDB Code 3e8u
Chain L

click to enlarge
Title Crystal structure and thermodynamic analysis of diagnostic Fab 106.3 complexed with BNP 5-13 (C10A) reveal basis of selective molecular recognition
Classification IMMUNE SYSTEM
Compound Fab 106.3 heavy chain
Source (3E8U)
Sequence L:  DNVLTQSPPSLAVSLGQRATISCKASQSVDYNGDSYLNWY
QQKPGQPPKFLIYAASNLESGIPARFSGSGSGTDFNLNIH
PVEEEDAATYYCQQSNEDPFTFGSGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRN
Description (1)  Fab 106.3 heavy chain, Fab 106.3 light chain, BNP peptide epitope

Display surface

Download
Links