eF-site ID 3e00-ADEG PDB Code 3e00 Chain A, D, E, G click to enlarge Title Intact PPAR gamma - RXR alpha Nuclear Receptor Complex on DNA bound with GW9662, 9-cis Retinoic Acid and NCOA2 Peptide Classification Transcription/DNA Compound Retinoic acid receptor RXR-alpha Source null (3E00) Sequence A:  KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTC RDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR ANEDMPVERILEAELAVEVTNICQAADKQLFTLVEWAKRI PHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILL ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTE LGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKH KYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP IDTFLMEML D:  MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYD RCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMP QAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSF PLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFQS KEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQ VTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILS GDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK DLY E:  KILHRLLQDS G:  KILHRLLQD Description Functional site 1) chain D residue 111 type sequence C description BINDING SITE FOR RESIDUE ZN D 7121 source : AC1 2) chain D residue 114 type sequence C description BINDING SITE FOR RESIDUE ZN D 7121 source : AC1 3) chain D residue 128 type sequence C description BINDING SITE FOR RESIDUE ZN D 7121 source : AC1 4) chain D residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN D 7121 source : AC1 5) chain D residue 148 type sequence C description BINDING SITE FOR RESIDUE ZN D 7122 source : AC2 6) chain D residue 152 type sequence C description BINDING SITE FOR RESIDUE ZN D 7122 source : AC2 7) chain D residue 162 type sequence C description BINDING SITE FOR RESIDUE ZN D 7122 source : AC2 8) chain D residue 165 type sequence C description BINDING SITE FOR RESIDUE ZN D 7122 source : AC2 9) chain A residue 135 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 10) chain A residue 138 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 11) chain A residue 152 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 12) chain A residue 155 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 13) chain A residue 171 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 14) chain A residue 177 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 15) chain A residue 187 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 16) chain A residue 190 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 17) chain A residue 268 type sequence I description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 18) chain A residue 271 type sequence A description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 19) chain A residue 275 type sequence Q description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 20) chain A residue 305 type sequence W description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 21) chain A residue 313 type sequence F description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 22) chain A residue 316 type sequence R description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 23) chain A residue 327 type sequence A description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 24) chain A residue 435 type sequence H description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 25) chain D residue 282 type sequence F description BINDING SITE FOR RESIDUE GW9 D 7123 source : AC6 26) chain D residue 285 type sequence C description BINDING SITE FOR RESIDUE GW9 D 7123 source : AC6 27) chain D residue 289 type sequence S description BINDING SITE FOR RESIDUE GW9 D 7123 source : AC6 28) chain D residue 330 type sequence L description BINDING SITE FOR RESIDUE GW9 D 7123 source : AC6 29) chain D residue 473 type sequence Y description BINDING SITE FOR RESIDUE GW9 D 7123 source : AC6 30) chain D residue 108-182 type DNA_BIND sequence AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDR CDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 31) chain D residue 111-131 type ZN_FING sequence CRVCGDKASGFHYGVHACEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 32) chain D residue 148-170 type ZN_FING sequence CDLNCRIHKKSRNKCQYCRFQKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 33) chain D residue 286 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 34) chain D residue 323 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 35) chain A residue 171 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 36) chain A residue 177 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 37) chain A residue 187 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 38) chain A residue 190 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 39) chain D residue 449 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 40) chain D residue 473 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 41) chain A residue 327 type MOD_RES sequence A description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 42) chain A residue 145 type MOD_RES sequence K description N6-acetyllysine; by EP300 => ECO:0000269|PubMed:17761950 source Swiss-Prot : SWS_FT_FI10 43) chain D residue 111-137 type prosite sequence CRVCGDKASGFHYGVHACEGCKGFFRR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CrvCg.Dkasgf.HYgvhaCegCkgFFrR source prosite : PS00031 44) chain A residue 135-161 type prosite sequence CAICGDRSSGKHYGVYSCEGCKGFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CrvCg.Dkasgf.HYgvhaCegCkgFFrR source prosite : PS00031 45) chain D residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:36737649 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links